Refolding Record:
Protein | |
---|---|
Protein Name | Penicillin-Binding Protein 2a |
Abbreviated Name | PBP |
SCOP Family | Unknown |
Structure Notes | |
Organism | Streptococcus pneumoniae |
UniProt Accession | P0A3M5 |
SCOP Unique ID | n/a |
Structure Solved | |
Class | Unknown |
Molecularity | Monomer |
Construct | |
---|---|
Full Length | y |
Domain | n/a |
Chimera | n/a |
Variants | n/a |
Chain Length | 691 |
Molecular Weight | 73872.9 |
Pi | 5.10255 |
Molecular Weight | 73872.9 |
Disulphides | Unknown |
Full Sequence |
MRKFNSHSIPIRLNLLFSIVILLFMTIIGRLLYMQVLNKDFYEKKLASASQTKITSSSAR
GEIYDASGKPLVENTLKQVVSFTRSNKMTATDLKETAKKLLTYVSISSPNLTERQLADYY
LADPEIYKKIVEALPSEKRLDSDGNRLSESELYNNAVDSVQTSQLNYTEDEKKEIYLFSQ
LNAVGNFATGTIATDPLNDSQVAVIASISKEMPGISISTSWDRKVLETSLSSIVGSVSSE
KAGLPAEEAEAYLKKGYSLNDRVGTSYLEKQYEETLQGKRSVKEIHLDKYGNMESVDTIE
EGSKGNNIKLTIDLAFQDSVDALLKSYFNSELENGGAKYSEGVYAVALNPKTGAVLSMSG
IKHDLKTGELTPDSLGTVTNVFVPGSVVKAATISSGWENGVLSGNQTLTDQSIVFQGSAP
INSWYTQAYGSFPITAVQALEYSSNTYMVQTALGLMGQTYQPNMFVGTSNLESAMEKLRS
TFGEYGLGTATGIDLPDESTGFVPKEYSFANYITNAFGQFDNYTPMQLAQYVATIANNGV
RVAPRIVEGIYGNNDKGGLGDLIQQLQPTEMNKVNISDSDMSILHQGFYQVAHGTSGLTT
GRAFSNGALVSISGKTGTAESYVADGQQATNTNAVAYAPSDNPQIAVAVVFPHNTNLTNG
VGPSIARDIINLYQKYHPMN
|
Notes | n/a |
Expression | |
---|---|
Report | Zhao G, Meier TI, Hoskins J, Jaskunas SR. (1999) Protein Expression and Purification, 16, 331-339 |
Project Aim | Structural Studies |
Fusion | N-terminal GST |
Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
Expression Host | Escherichia coli |
Expression Strain | DH5alpha |
Expression Temp | 32.0 |
Expression Time | 3h |
Expression Vector | pGEX-2T |
Expression Protocol | unknown |
Method of Induction | Not Stated |
Cell Density at Induction | OD = |
Cell Disruption Method | French Press |
Lytic Agent | None |
Pre-Refolding Purification | None |
Solubility | insoluble |
Refolding | |
---|---|
Refolding Method | Dialysis |
Wash Buffer | 50mM Tris-HCl, 1mM EDTA, 100mM KCl, pH 7.5 |
Solubilization Buffer | 7.5M urea |
Refolding Buffer | 50mM Tris-HCl, 1mM EDTA, 100mM KCl |
Pre-Refolding Purification | None |
Tag Cleaved | yes |
Refolding pH | 7.5 |
Refolding Temperature | 4.0 |
Protein Concentration | |
Refolding Time | 16h |
Redox Agent | None |
Redox Agent Concentration | n/a |
Refolding Protocol | The inclusion bodies were washed 6 times with 50mM Tris-HCl, 1mM EDTA, 100mM KCl, pH 7.5. The protein was solubilixed with 7.5M urea and refolded by dialysis against 50mM Tris-HCl, 1mM EDTA, 100mM KCl, pH 7.5. |
Refolding Assay | Enzyme activity |
Refolding Chaperones | None |
Refolding Additives | None |
Additives Concentration | NULL |
Refolding Yield | 37mg/L culture - 36% |
Purity | 90-95% pure |
Notes |