Refolding Record:
| Construct | |
|---|---|
| Full Length | y |
| Domain | n/a |
| Chimera | n/a |
| Variants | n/a |
| Chain Length | 169 |
| Molecular Weight | 20011.0 |
| Pi | 9.01804 |
| Molecular Weight | 20011.0 |
| Disulphides | 1 |
| Full Sequence |
MSYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF
QKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKT
VLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEI
LRNFYFINRLTGYLRN
|
| Notes | n/a |
| Expression | |
|---|---|
| Report | Unpublished (0) J Virol Methods, 0, 0 |
| Project Aim | Folding,Antigenic Determinant Identification,Cloning and expression,Analysis,Analysis,Analysis |
| Fusion | N-terminal thioredoxin + hexahistidine tag |
| Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
| Expression Host | E.coli |
| Expression Strain | bl21 de3 |
| Expression Temp | 37.0 |
| Expression Time | 4hrs |
| Expression Vector | pet 44 |
| Expression Protocol | Luria Broth in Erlenmeyer flask |
| Method of Induction | IPTG |
| Cell Density at Induction | OD 2 = n/a |
| Cell Disruption Method | Cell disrupter |
| Lytic Agent | Lysozyme |
| Pre-Refolding Purification | None |
| Solubility | insoluble |
| Refolding | |
|---|---|
| Refolding Method | Dilution/Column Refolding Combination |
| Wash Buffer | Urea 6m pH 8 |
| Solubilization Buffer | Urea 6m pH 12 |
| Refolding Buffer | Dont know |
| Pre-Refolding Purification | None |
| Tag Cleaved | no |
| Refolding pH | 8.0 |
| Refolding Temperature | 37.0 |
| Protein Concentration | n/a |
| Refolding Time | n/a |
| Redox Agent | Beta-mercaptoethanol |
| Redox Agent Concentration | n/a |
| Refolding Protocol | n/a |
| Refolding Assay | Bradford assay,Activity assay,Biological assay,Biochemical analyses |
| Refolding Chaperones | None |
| Refolding Additives | None |
| Additives Concentration | n/a |
| Refolding Yield | n/a |
| Purity | n/a |
| Notes | n/a |