Refolding Record:
| Protein | |
|---|---|
| Protein Name | Phosphomannose isomerase |
| Abbreviated Name | PMI |
| SCOP Family | Type I phosphomannose isomerase |
| Structure Notes | |
| Organism | Candida albicans |
| UniProt Accession | P34948 |
| SCOP Unique ID | n/a |
| Structure Solved | |
| Class | Beta |
| Molecularity | Monomer |
| Construct | |
|---|---|
| Full Length | y |
| Domain | n/a |
| Chimera | n/a |
| Variants | n/a |
| Chain Length | 447 |
| Molecular Weight | 48735.4 |
| Pi | 5.15617 |
| Molecular Weight | 48735.4 |
| Disulphides | 0 |
| Full Sequence |
SSEKLFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSK
AIDLNNQTLRDLVTAKPQEYLGESIITKFGSSKELPFLFKVLSIEKVLSIQAHPDKKLGA
QLHAADPKNYPDDNHKPEMAIAVTDFEGFCGFKPLDQLAKTLATVPELNEIIGQELVDEF
ISGIKLPAEVGSQDDVNNRKLLQKVFGKLMNTDDDVIKQQTAKLLERTDREPQVFKDIDS
RLPELIQRLNKQFPNDIGLFCGCLLLNHVGLNKGEAMFLQAKDPHAYISGDIIECMAASD
NVVRAGFTPKFKDVKNLVEMLTYSYESVEKQKMPLQEFPRSKGDAVKSVLYDPPIAEFSV
LQTIFDKSKGGKQVIEGLNGPSIVIATNGKGTIQITGDDSTKQKIDTGYVFFVAPGSSIE
LTADSANQDQDFTTYRAFVEA
|
| Notes | n/a |
| Expression | |
|---|---|
| Report | Proudfoot AE, Goffin L, Payton MA, Wells TN, Bernard AR. (1996) Biochem J., 318, 437-442 |
| Project Aim | Structure-Function |
| Fusion | None |
| Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
| Expression Host | Escherichia coli |
| Expression Strain | BL21 |
| Expression Temp | 37.0 |
| Expression Time | 4h |
| Expression Vector | pTPG9 and pOF39 |
| Expression Protocol | unknown |
| Method of Induction | Not Stated |
| Cell Density at Induction | OD = |
| Cell Disruption Method | Sonication/French Press |
| Lytic Agent | None |
| Pre-Refolding Purification | None |
| Solubility | not stated |
| Refolding | |
|---|---|
| Refolding Method | Dilution/Column Refolding Combination |
| Wash Buffer | 50mM Tris-HCl containing 0.1mM PMSF, 1mM benzamidine hydrocholride and 1mM EDTA |
| Solubilization Buffer | 0.1M Tris-HCl containing 6M Gdn-HCl and 1mM DTT |
| Refolding Buffer | unknown |
| Pre-Refolding Purification | None |
| Tag Cleaved | no tag |
| Refolding pH | 7.5 |
| Refolding Temperature | 25.0 |
| Protein Concentration | 30% |
| Refolding Time | |
| Redox Agent | DTT |
| Redox Agent Concentration | n/a |
| Refolding Protocol | unknown |
| Refolding Assay | Enzyme activity |
| Refolding Chaperones | None |
| Refolding Additives | None |
| Additives Concentration | NULL |
| Refolding Yield | |
| Purity | |
| Notes | |