Refolding Record:
| Protein | |
|---|---|
| Protein Name | Interferon gamma |
| Abbreviated Name | IFN gamma |
| SCOP Family | Interferons/interleukin-10 (IL-10) |
| Structure Notes | |
| Organism | Human |
| UniProt Accession | P01579 |
| SCOP Unique ID | n/a |
| Structure Solved | |
| Class | Alpha |
| Molecularity | Dimer |
| Construct | |
|---|---|
| Full Length | y |
| Domain | n/a |
| Chimera | n/a |
| Variants | n/a |
| Chain Length | 140 |
| Molecular Weight | 16177.5 |
| Pi | 9.52198 |
| Molecular Weight | 16177.5 |
| Disulphides | 0 |
| Full Sequence |
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
|
| Notes | n/a |
| Expression | |
|---|---|
| Report | Wang L, Geng X, Han H (2003) Journal of Northwest University, 33, 540-544 |
| Project Aim | Undefined |
| Fusion | None |
| Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
| Expression Host | Escherichia coli |
| Expression Strain | DH5¦Á |
| Expression Temp | 37.0 |
| Expression Time | 12h |
| Expression Vector | pBV 220 |
| Expression Protocol | unknown |
| Method of Induction | Not Stated |
| Cell Density at Induction | OD = |
| Cell Disruption Method | Sonication |
| Lytic Agent | None |
| Pre-Refolding Purification | Washing inclusion body |
| Solubility | insoluble |
| Refolding | |
|---|---|
| Refolding Method | Column refolding: hydrophobic interaction chromatography |
| Wash Buffer | 2.0 M urea + 20 mM PBS |
| Solubilization Buffer | 8.0 M urea |
| Refolding Buffer | 50 mM PBS |
| Pre-Refolding Purification | Washing inclusion body |
| Tag Cleaved | no tag |
| Refolding pH | 7.0 |
| Refolding Temperature | 25.0 |
| Protein Concentration | |
| Refolding Time | |
| Redox Agent | None |
| Redox Agent Concentration | n/a |
| Refolding Protocol | SCF was purified by HPHIC on a prepacked column. The column liquid chromatography was performed at room temperature on a HPLC system. The SCF extract was directly injected into the HPHIC column previously equilibrated with solution A (3.0 mol/L ammonium sulfate containing 0.05 mol/L phosphate, pH 7.0) ,The protein desorption was performed using a linear gradient elution in 25 min. HPHIC flow rate was 1.0 mL/min at UV detection was set at 280 nm. |
| Refolding Assay | Bioactivity |
| Refolding Chaperones | None |
| Refolding Additives | None |
| Additives Concentration | NULL |
| Refolding Yield | |
| Purity | |
| Notes | |