Refolding Record:
Protein | |
---|---|
Protein Name | Minichromosome maintenance 8 |
Abbreviated Name | MCM8 |
SCOP Family | DNA helicases |
Structure Notes | |
Organism | Xenopus laevis |
UniProt Accession | Q5F310 |
SCOP Unique ID | n/a |
Structure Solved | |
Class | Alpha+Beta |
Molecularity | Unknown |
Construct | |
---|---|
Full Length | y |
Domain | n/a |
Chimera | n/a |
Variants | n/a |
Chain Length | 847 |
Molecular Weight | 92543.4 |
Pi | 7.49555 |
Molecular Weight | 92543.4 |
Disulphides | Unknown |
Full Sequence |
MSQGWRGGSGGWRGGGGGGGNPYAGAWRGRPWRGRGQGGTWSRNNGRDPVCFAPPKPQLT
QTTLDKYIPYKGWKLYFSEAYSDNSPFLEKVRAFEKFFKKQIELYDKDEIERKGSILVDY
KELLQDEDLSASIPLSSELKDMPEKVLECMGLAIHQVLTKDLETHAADLQQQEGLRTEEA
PIVNVPFIHARVFNYDTLTSLKNLRASLYGKYVALRGTVVRVGNIKPLCTKMAFSCNMCG
DIQCFPLPDGKYTVPTKCPVPECRGRSFTANRSSPLTVTVDWQTIKVQELMSDDQREAGR
IPRTVECELIQDLVDSCVPGDMITVTGIVKVSNTRDGGFKNKNNKCMFLLYIEANSVSNS
KGQKGKSTEDSGNHGASMDFSLKDLYAIQEIQSQENLFQLIVNSLCPTIYGHELVKAGLS
LALFGGCQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAVCNVAPRGVYVCGNTTTTS
GLTVTLSRDTTTGDFGLEAGALVLGDQGICGIDEFDKMGNQHQALLEAMEQQSISLAKAG
IVCSLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILVDTPNEDHDHLL
SEHVMAMRSGAKEIQSVDITRINTQNSNTSILEVPSERPLGERLKLRTGEHFDALPHQLL
RKFVGYARQYVHPSLSPDAAQILQDFYLELRKQNQGIDSTPITTRQLESLIRLTEARARL
ELREKATKEDAEEVVQIMKYSLLGTFSDEFGKLDFQRSQHGSGMSNRSKAKKFVSALNRV
AEQTYNNLFEFQQLRQIARELQIQVIDFEAFIGSLNDQGYLLKKGPRVFQLQTM
|
Notes | n/a |
Expression | |
---|---|
Report | Maiorano, D., Cuvier, O., Danis, E., Mechali, M. (2005) Cell, 120, 315-328 |
Project Aim | Undefined |
Fusion | N-terminal hexahistidine tag |
Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
Expression Host | Escherichia coli |
Expression Strain | BL21 |
Expression Temp | 37.0 |
Expression Time | 3 hours |
Expression Vector | pRSET |
Expression Protocol | unknown |
Method of Induction | Not Stated |
Cell Density at Induction | OD = |
Cell Disruption Method | Sonication |
Lytic Agent | None |
Pre-Refolding Purification | None |
Solubility | insoluble |
Refolding | |
---|---|
Refolding Method | Dilution |
Wash Buffer | 100 mM NaH2PO4, 10 mM TrisHCl, 8 M Urea, pH 6.3 |
Solubilization Buffer | 100 mM NaH2PO4, 10 mM TrisHCl, 8 M Urea, pH 8.0 |
Refolding Buffer | 50 mM Hepes, 0.2M NaCl, 1 mM DTT, 1 M NDSB201 |
Pre-Refolding Purification | None |
Tag Cleaved | no |
Refolding pH | 7.5 |
Refolding Temperature | 4.0 |
Protein Concentration | 0.1 mg/ml |
Refolding Time | 1 hour |
Redox Agent | DTT |
Redox Agent Concentration | n/a,n/a |
Refolding Protocol | Protocol Dilute your protein 10-fold into ice-cold refolding buffer as quickly as possible so that the final protein concentration will not exceed 0.1-0.05 mg/ml. For small volumes (1-10 ml) the protein can be added directly into the refolding buffer in a 15 ml Falcon tube while vortexing. Keep vortexing for 30 seconds after addition. For larger volumes, the protein can be added into a becker containing the refolding buffer while vigourously stirring. Keep stirring for 2 minutes after addition. Leave on ice 1 hour. The protein can be now dyalized and concentrated by centrifugation through a Microcon-30 device (Millipore) at 4 °C. |
Refolding Assay | Bioactivity |
Refolding Chaperones | None |
Refolding Additives | None |
Additives Concentration | NULL |
Refolding Yield | 1 mg/ml |
Purity | 99% |
Notes |