Refolding Record:
Protein | |
---|---|
Protein Name | AtMinD1 |
Abbreviated Name | AtMinD1 |
SCOP Family | Unknown |
Structure Notes | |
Organism | Arabidopsis thaliana |
UniProt Accession | Q9MBA2 |
SCOP Unique ID | n/a |
Structure Solved | |
Class | Unknown |
Molecularity | Monomer |
Construct | |
---|---|
Full Length | n |
Domain | n/a |
Chimera | n/a |
Variants | AtMinD1(K72A) |
Chain Length | 326 |
Molecular Weight | 35633.3 |
Pi | 6.65 |
Molecular Weight | 35633.3 |
Disulphides | 0 |
Full Sequence |
MASLRLFSTNHQSLLLPSSLSQKTLISSPRFVNNPSRRSPIRSVLQFNRKPELAGETPRIVVITSGKGGVGATTTTANVGLSLARYGFSVVAIDADLGLRNLDLLLGLENRVNYTCVEVINGDCRLDQALVRDKRWSNFELLCISKPRSKLPMGFGGKALEWLVDALKTRPEGSPDFIIIDCPAGIDAGFITAITPANEAVLVTTPDITALRDADRVTGLLECDGIRDIKMIVNRVRTDMIKGEDMMSVLDVQEMLGLSLLGVIPEDSEVIRSTNRGFPLVLNKPPTLAGLAFEQAAWRLVEQDSMKAVMVEEEPKKRGFFSFFGG
|
Notes | n/a |
Expression | |
---|---|
Report | Aldridge, C., Moller, S.G. (2005) J Biol Chem, 280, 31673-31678 |
Project Aim | Functional Studies |
Fusion | N-terminal hexahistidine tag |
Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
Expression Host | Escherichia coli |
Expression Strain | BL21(D3) |
Expression Temp | 37.0 |
Expression Time | 2h |
Expression Vector | pET14b |
Expression Protocol | Cells were grown to a density of OD600:0.6 before induction with 1.5 mM ITPG. After incubation prote |
Method of Induction | IPTG |
Cell Density at Induction | OD 600 = 0.6 |
Cell Disruption Method | None |
Lytic Agent | None |
Pre-Refolding Purification | Metal affinity chromatography |
Solubility | insoluble |
Refolding | |
---|---|
Refolding Method | Dialysis |
Wash Buffer | n/a |
Solubilization Buffer | not stated |
Refolding Buffer | 50 mM sodium phosphate, 50 mM NaCl, 0.1 M EDTA, 1.5 mM DTT, 10%glycerol, ph 7 over 8-0 urea gradient |
Pre-Refolding Purification | Metal affinity chromatography |
Tag Cleaved | no |
Refolding pH | 7.0 |
Refolding Temperature | 37.0 |
Protein Concentration | n/a |
Refolding Time | n/a |
Redox Agent | DTT |
Redox Agent Concentration | 1.5 mM |
Refolding Protocol | Refolding occured via dialysis against refolding buffer. |
Refolding Assay | Enzyme activity |
Refolding Chaperones | None |
Refolding Additives | Glycerol |
Additives Concentration | n/a |
Refolding Yield | n/a |
Purity | n/a |
Notes | n/a |