Refolding Record:
Protein | |
---|---|
Protein Name | Prohibitin |
Abbreviated Name | Prohibitin |
SCOP Family | Unknown |
Structure Notes | |
Organism | Human |
UniProt Accession | P35232 |
SCOP Unique ID | n/a |
Structure Solved | |
Class | Unknown |
Molecularity | Tetramer |
Construct | |
---|---|
Full Length | y |
Domain | n/a |
Chimera | n/a |
Variants | n/a |
Chain Length | 253 |
Molecular Weight | 28272.1 |
Pi | 5.74 |
Molecular Weight | 28272.1 |
Disulphides | 0 |
Full Sequence |
AGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQPWEDPDHHHHHH
|
Notes | n/a |
Expression | |
---|---|
Report | Bacher, S., Achatz, G., Schmitz, M. L., Lamers, M. C. (2002) Biochimie, 84, 1205-1218 |
Project Aim | Crystallography,Protein-Protein Interaction Identification |
Fusion | C-terminal hexahistidine tag |
Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
Expression Host | Escherichia coli |
Expression Strain | M15 |
Expression Temp | 37.0 |
Expression Time | 6h |
Expression Vector | pQE-60 |
Expression Protocol | 1 L of LB medium containing ampicillin and kanamycin was inoculated with cells and grown to appropri |
Method of Induction | IPTG |
Cell Density at Induction | OD 600 = 0.7 |
Cell Disruption Method | None |
Lytic Agent | None |
Pre-Refolding Purification | None |
Solubility | insoluble |
Refolding | |
---|---|
Refolding Method | Column refolding: Nickel-chelating chromatography |
Wash Buffer | n/a |
Solubilization Buffer | 6 M GuHCl, 0.1 M NaH2PO4, 0.01 M Tris·Cl, pH 8.0 |
Refolding Buffer | decreasing concentration denaturant 0.1 M NaH2PO4, 0.01 M Tris·Cl, pH 8.0 |
Pre-Refolding Purification | None |
Tag Cleaved | no |
Refolding pH | 8.0 |
Refolding Temperature | 37.0 |
Protein Concentration | n/a |
Refolding Time | n/a |
Redox Agent | None |
Redox Agent Concentration | n/a |
Refolding Protocol | Recombinant prtoteins were purified by the addition of denaturing buffer (Qiagen) and refolded on a Ni-NTA agrose column by sequentail washing with decreasing concentrations of denaturant. Protein was eluted by washing with HBS containing 100mM imidazole, followed by dialysis. |
Refolding Assay | Surface plasmon resonance binding |
Refolding Chaperones | None |
Refolding Additives | None |
Additives Concentration | n/a |
Refolding Yield | n/a |
Purity | n/a |
Notes | n/a |