Refolding Record:
Protein | |
---|---|
Protein Name | Rad51A protein |
Abbreviated Name | Rad51A |
SCOP Family | Helicase |
Structure Notes | |
Organism | Physcomitrella patens |
UniProt Accession | Q93V52 |
SCOP Unique ID | n/a |
Structure Solved | |
Class | Unknown |
Molecularity | Unknown |
Construct | |
---|---|
Full Length | y |
Domain | n/a |
Chimera | n/a |
Variants | n/a |
Chain Length | 335 |
Molecular Weight | 36428.5 |
Pi | 5.6 |
Molecular Weight | 36428.5 |
Disulphides | Unknown |
Full Sequence |
MATVSAATEGVTEEEVHHGPYLVEQLQNCGISSLDLKKLKDAGFCTVESVAYSAKKDLVLIKGLSDAKDKIIEAATKLVPMGFTSAKQMHEQRAELIQITTGAKEFDILEGGIETGSITEIYGEFRSEKSQICHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIAEKYGLNGQDVLDNVAYARAYNTDHQMKLLVEAASMMAETRFALMVVDSSTALYRTDYSGRGELAARQVHLAKFLRGCQKIADEFGIAVVITNQVVAQVDGSAMFNGPQHKPIGGNIIAHASTTRLSVRKGRGEERVIKVVASPCLAEQEQRFQITNEGAVDVKE
|
Notes | Sequence provided refers to recA protein only. |
Expression | |
---|---|
Report | Ayora, S., Piruat, J. I., Luna, R., Reiss, B., Russo, V. E. A., Aguilera, A., Alonso, J. C. (2002) J Mol Biol, 316, 35-49 |
Project Aim | Undefined |
Fusion | None |
Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
Expression Host | Escherichia coli |
Expression Strain | BL21(DE3) |
Expression Temp | 37.0 |
Expression Time | 2.5 |
Expression Vector | pET-3b |
Expression Protocol | 30 min after induction with IPTG, 150 microg/ml rifampicin was added and cells were incubated for a |
Method of Induction | IPTG |
Cell Density at Induction | OD 560 = 0.8 |
Cell Disruption Method | Sonication |
Lytic Agent | None |
Pre-Refolding Purification | Ion-exchange chromatography |
Solubility | not stated |
Refolding | |
---|---|
Refolding Method | Dialysis |
Wash Buffer | 50 mM TrisHCl, pH 7.5, 1 M NaCl, 1 mM DTT, 0.5 mM EDTA, 5%(v/v) glycerol |
Solubilization Buffer | 4 M urea, 50 mM TrisHCl, pH 7.5, 1 mM DTT, 0.5 mM EDTA, 5%(v/v) glycerol |
Refolding Buffer | 500 mM NaCl, 50 mM TrisHCl, pH 7.5, 1 mM DTT, 0.5 mM EDTA, 5%(v/v) glycerol |
Pre-Refolding Purification | Ion-exchange chromatography |
Tag Cleaved | no tag |
Refolding pH | 7.5 |
Refolding Temperature | 25.0 |
Protein Concentration | n/a |
Refolding Time | n/a |
Redox Agent | DTT |
Redox Agent Concentration | 1 mM |
Refolding Protocol | Inclusion bodies were washed three times in washing buffer, and then solubilized. The solution was then centrifuged and the supernatant loaded onto a Q-Sepharose column equilibrated with solubilization buffer containing 10 mM NaCl. Proteins were then eluted by using a linear gradient from 10-100 mM NaCl and 4 M urea. Rad51 were refolded by dialysis against equal volumes of refolding buffer. They were then dialyzed against refolding buffer containing 300 mM NaCl, 50% glycerol rather than 500mM Nacl and 5% glycerol. This solution was then centrifuged(45,000rpm, 1h) and stored at -20degC. |
Refolding Assay | DNA binding |
Refolding Chaperones | None |
Refolding Additives | Glycerol |
Additives Concentration | 5% |
Refolding Yield | n/a |
Purity | n/a |
Notes | n/a |