Refolding Record:
Protein | |
---|---|
Protein Name | Beta crystallin A4 |
Abbreviated Name | BA4 |
SCOP Family | Crystallins/Ca-binding development proteins |
Structure Notes | |
Organism | Human |
UniProt Accession | P53673 |
SCOP Unique ID | n/a |
Structure Solved | |
Class | Beta |
Molecularity | Dimer |
Construct | |
---|---|
Full Length | y |
Domain | n/a |
Chimera | n/a |
Variants | n/a |
Chain Length | 215 |
Molecular Weight | 24279.9 |
Pi | 5.71 |
Molecular Weight | 24279.9 |
Disulphides | 0 |
Full Sequence |
TLQCTKSAGPWKMVVWDEDGFQGRRHEFTAECPSVLELGFETVRSLKVLSGAWVGFEHAGFQGQQYILERGEYPSWDAWGGNTAYPAERLTSFRPAACANHRDSRLTIFEQENFLGKKGELSDDYPSLQAMGWEGNEVGSFHVHSGAWVCSQFPGYRGFQYVLECDHHSGDYKHFREWGSHAPTFQVQSIRRIQQDPAANKARKEAELAAATAEQ
|
Notes | n/a |
Expression | |
---|---|
Report | Bateman, O.A., Sarra, R., van Genesen, S.T., Kappe, G., Lubsen, N.H., Slingsby, C. (2003) Exp Eye Res, 77, 409-422 |
Project Aim | Structural Studies |
Fusion | C-terminal sequence |
Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
Expression Host | Escherichia coli |
Expression Strain | BL21pLys |
Expression Temp | 37.0 |
Expression Time | 4 |
Expression Vector | pET3a |
Expression Protocol | 2L of LB containing ampicillin and chloramphenicol medium was inoculated with overnight culture. Cel |
Method of Induction | IPTG |
Cell Density at Induction | OD 600 = 0.3 |
Cell Disruption Method | Sonication |
Lytic Agent | None |
Pre-Refolding Purification | None |
Solubility | not stated |
Refolding | |
---|---|
Refolding Method | Dilution |
Wash Buffer | n/a |
Solubilization Buffer | 8 M urea, 10 mM TrisHCl, 1 mM EDTA, 1 mM DTT, pH 8.0 |
Refolding Buffer | 25 mM TrisHCl, 2mM EDTA, 1mM DTT, pH 8.0 |
Pre-Refolding Purification | None |
Tag Cleaved | no |
Refolding pH | 8.0 |
Refolding Temperature | 25.0 |
Protein Concentration | n/a |
Refolding Time | overnig |
Redox Agent | None |
Redox Agent Concentration | n/a |
Refolding Protocol | Pellet of insoluble material from bacterial lysate was dissolved in 10ml Solubilization Buffer. The solution was then added drop wise to 100ml Refolding buffer. The mixture was then loaded onto a 40ml DEAE Sepharose fast flow column equilibrated with buffer A (25 mM TrisHCl, 2mM EDTA, pH 8.0). The column was eluted with one column volume of buffer A followed by 10% buffer B (buffer A with 1 M NaCl). |
Refolding Assay | Far-UV Circular Dichroism,Fluorescence |
Refolding Chaperones | None |
Refolding Additives | None |
Additives Concentration | n/a |
Refolding Yield | n/a |
Purity | n/a |
Notes | n/a |