Refolding Record:
Protein | |
---|---|
Protein Name | Integrin beta-2 |
Abbreviated Name | Integrin beta-2 |
SCOP Family | Integrin beta EGF-like domains |
Structure Notes | |
Organism | Human |
UniProt Accession | P05107 |
SCOP Unique ID | n/a |
Structure Solved | |
Class | Small Proteins |
Molecularity | Monomer |
Construct | |
---|---|
Full Length | n |
Domain | n/a |
Chimera | n/a |
Variants | Integrin beta-2 subunit repeat 2 residues 460-513 |
Chain Length | 54 |
Molecular Weight | 5774.5 |
Pi | 5.64 |
Molecular Weight | 5774.5 |
Disulphides | 3 |
Full Sequence |
HGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCV
|
Notes | Sequence refers only to the sequence of the integrin fragment as details on expression vector were not supplied |
Expression | |
---|---|
Report | Beglova, N., Blacklow, S. C., Takagi, J., Springer, T. A. (2002) Nature Structural Biology, 9, 282-287 |
Project Aim | Structural Studies |
Fusion | None |
Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
Expression Host | Escherichia coli |
Expression Strain | None |
Expression Temp | 37.0 |
Expression Time | not stated |
Expression Vector | pMM |
Expression Protocol | Expression protocol not supplied. |
Method of Induction | Not Stated |
Cell Density at Induction | OD n/a = n/a |
Cell Disruption Method | None |
Lytic Agent | None |
Pre-Refolding Purification | None |
Solubility | not stated |
Refolding | |
---|---|
Refolding Method | Dialysis |
Wash Buffer | n/a |
Solubilization Buffer | n/a |
Refolding Buffer | 2.5 mM reduced glutathione, 0.5 mM oxidized glutathione, 10 mM Tris, pH 8.2 |
Pre-Refolding Purification | None |
Tag Cleaved | no |
Refolding pH | 8.2 |
Refolding Temperature | 4.0 |
Protein Concentration | n/a |
Refolding Time | n/a |
Redox Agent | None |
Redox Agent Concentration | n/a |
Refolding Protocol | Refolding was preformed by dialysis. The refolded protein was then purified by reversed-phase HPLC and their identities were verified by MALDI-TOF mass spectrometry. |
Refolding Assay | RNA binding,Structure Determination |
Refolding Chaperones | None |
Refolding Additives | None |
Additives Concentration | n/a |
Refolding Yield | n/a |
Purity | n/a |
Notes | n/a |