Refolding Record:
| Protein | |
|---|---|
| Protein Name | Integrin beta-2 |
| Abbreviated Name | Integrin beta-2 |
| SCOP Family | Integrin beta EGF-like domains |
| Structure Notes | |
| Organism | Human |
| UniProt Accession | P05107 |
| SCOP Unique ID | n/a |
| Structure Solved | |
| Class | Small Proteins |
| Molecularity | Monomer |
| Construct | |
|---|---|
| Full Length | n |
| Domain | n/a |
| Chimera | n/a |
| Variants | Integrin beta-2 subunit repeat 2 residues 460-513 |
| Chain Length | 54 |
| Molecular Weight | 5774.5 |
| Pi | 5.64 |
| Molecular Weight | 5774.5 |
| Disulphides | 3 |
| Full Sequence |
HGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCV
|
| Notes | Sequence refers only to the sequence of the integrin fragment as details on expression vector were not supplied |
| Expression | |
|---|---|
| Report | Beglova, N., Blacklow, S. C., Takagi, J., Springer, T. A. (2002) Nature Structural Biology, 9, 282-287 |
| Project Aim | Structural Studies |
| Fusion | None |
| Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
| Expression Host | Escherichia coli |
| Expression Strain | None |
| Expression Temp | 37.0 |
| Expression Time | not stated |
| Expression Vector | pMM |
| Expression Protocol | Expression protocol not supplied. |
| Method of Induction | Not Stated |
| Cell Density at Induction | OD n/a = n/a |
| Cell Disruption Method | None |
| Lytic Agent | None |
| Pre-Refolding Purification | None |
| Solubility | not stated |
| Refolding | |
|---|---|
| Refolding Method | Dialysis |
| Wash Buffer | n/a |
| Solubilization Buffer | n/a |
| Refolding Buffer | 2.5 mM reduced glutathione, 0.5 mM oxidized glutathione, 10 mM Tris, pH 8.2 |
| Pre-Refolding Purification | None |
| Tag Cleaved | no |
| Refolding pH | 8.2 |
| Refolding Temperature | 4.0 |
| Protein Concentration | n/a |
| Refolding Time | n/a |
| Redox Agent | None |
| Redox Agent Concentration | n/a |
| Refolding Protocol | Refolding was preformed by dialysis. The refolded protein was then purified by reversed-phase HPLC and their identities were verified by MALDI-TOF mass spectrometry. |
| Refolding Assay | RNA binding,Structure Determination |
| Refolding Chaperones | None |
| Refolding Additives | None |
| Additives Concentration | n/a |
| Refolding Yield | n/a |
| Purity | n/a |
| Notes | n/a |