Refolding Record:
Protein | |
---|---|
Protein Name | Basic membrane protein C |
Abbreviated Name | BmpC |
SCOP Family | Unknown |
Structure Notes | |
Organism | Borrelia burgdorferi |
UniProt Accession | Q45011 |
SCOP Unique ID | n/a |
Structure Solved | |
Class | Unknown |
Molecularity | Monomer |
Construct | |
---|---|
Full Length | y |
Domain | n/a |
Chimera | n/a |
Variants | n/a |
Chain Length | 369 |
Molecular Weight | 41227.6 |
Pi | 8.98 |
Molecular Weight | 41227.6 |
Disulphides | 0 |
Full Sequence |
FKSNKKSIKSDKVVVGVLAHGSFYDKGYNQSVHDGVVKLRDNFGIKLITKSLRPYPIEGKRLLTVDEAMTEDAYEVQKNPLNLFWLIGYRFSDLSVKLSYERPDIYYGIIDAFDYGDIQVPKNSLAIKFRNEEAAFLAGYIAAKMSRKEKIGFLTGPMSEHVKDFKFGFKAGIFYANPKLRLVSKKAPSLFDKEKGKAMALFMYKEDKVGVIFPIAGITGLGVYDAAKELGPKYYVIGLNQDQSYIAPQNVITSIIKDIGKVIYSISSEYINNRVFKGGIIIDRGLKEGVIEIVKDPDVLNNRLVDEVIDLENKIISGEIIVPDSEYAFDLFKSKLGRSNSPLAMAISDPNSSSVDKLAAALGHHHHHH
|
Notes | n/a |
Expression | |
---|---|
Report | Bryksin, A. V., Godfery, H. P., Carbonaro, C. A., Wormser, G. P., Aguero-Rosenfeld, M. E., Cabello, F. C (2005) Clin Diagn Lab Immunol, 12, 935-940 |
Project Aim | Structure-Function |
Fusion | C-terminal hexahistidine tag |
Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
Expression Host | Escherichia coli |
Expression Strain | BL21-CodonPlus-RIL |
Expression Temp | 37.0 |
Expression Time | 2h |
Expression Vector | pET30 Xa/LIC |
Expression Protocol | Cells were grown in 2YT medium and induced for two hours. After lysis, inclusion bodies were collected by centrifugation and washed with washing buffer. |
Method of Induction | IPTG |
Cell Density at Induction | OD 600 = 0.7 |
Cell Disruption Method | Not stated |
Lytic Agent | None |
Pre-Refolding Purification | Metal affinity chromatography |
Solubility | insoluble |
Refolding | |
---|---|
Refolding Method | Dialysis |
Wash Buffer | PBS, 0.05% Triton X-100 |
Solubilization Buffer | 7M urea, 10mM DTT |
Refolding Buffer | PBS, 0.05% Triton X-100 |
Pre-Refolding Purification | Metal affinity chromatography |
Tag Cleaved | no |
Refolding pH | 7.4 |
Refolding Temperature | 25.0 |
Protein Concentration | n/a |
Refolding Time | n/a |
Redox Agent | DTT |
Redox Agent Concentration | 10mM |
Refolding Protocol | Inclusion bodies were washed and solubilized. rBMP proteins were purified on a HisBind Quick (Novagen) and refolded in refolding buffer dialyzed against Ficoll 400. |
Refolding Assay | Immunoassay |
Refolding Chaperones | None |
Refolding Additives | Triton X-100 |
Additives Concentration | 0.05% |
Refolding Yield | n/a |
Purity | n/a |
Notes | n/a |