Refolding Record:
Protein | |
---|---|
Protein Name | Penicillin-binding protein 1 |
Abbreviated Name | PBP1 |
SCOP Family | Penicillin binding protein dimerisation domain |
Structure Notes | |
Organism | Mycobacterium tuberculosis |
UniProt Accession | Q8VKS5 |
SCOP Unique ID | n/a |
Structure Solved | |
Class | Alpha+Beta |
Molecularity | Dimer |
Construct | |
---|---|
Full Length | n |
Domain | n/a |
Chimera | n/a |
Variants | (V2-S127)PBP1 |
Chain Length | 556 |
Molecular Weight | 57970.0 |
Pi | 5.24 |
Molecular Weight | 57970.0 |
Disulphides | 0 |
Full Sequence |
MGSSHHHHHHSSGLVPRGSHMKDDVLQAYLNIIYFGRGAYGISAASKAYFDKPVEQLTVAEGALLAALIRRPSTLDPAVDPEGAHARWNWVLDGMVETKALSPNDRAAQVFPETVPPDLARAENQTKGPNGLIERQVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTADNTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPPPPSEVPPSETVIQPTVEIAPGITIPIGPPTTITLAPPPPAPPAATPTPPP
|
Notes | Mutant, lacking residues V2-S127 |
Expression | |
---|---|
Report | Bhakta, S., Basu, J. (2002) Biochem J., 361, 635-639 |
Project Aim | Functional Studies,Recombinant Protein Expression |
Fusion | N-terminal hexahistidine tag |
Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
Expression Host | Escherichia coli |
Expression Strain | BL21(DE3) |
Expression Temp | 30.0 |
Expression Time | 3h |
Expression Vector | pET28a |
Expression Protocol | Cells were grown in LB broth (supplemented with 50microg/ml kanamycin), at 37degC, overnight with shaking. Cells were then induced and incubated prior to harvesting. Harvested cells were resusupended in Buffer A (10mM TrisHCl, pH 7.4, 1 mM MgCl2, 1 microg/ml DNAse), and sonicated (200W for 2 min). Lysate was then centrifuged(600g, 10min), and inclusion bodies isolated by further centrifugation (5000g, 10min). |
Method of Induction | IPTG |
Cell Density at Induction | OD 600 = 0.6 |
Cell Disruption Method | Sonication |
Lytic Agent | None |
Pre-Refolding Purification | Metal affinity chromatography |
Solubility | insoluble |
Refolding | |
---|---|
Refolding Method | Dialysis |
Wash Buffer | n/a |
Solubilization Buffer | 5 M guanidineHGl, 150 mM TrisHCl, pH 8.0, 1 mM DTT, 1 mM EDTA |
Refolding Buffer | 400 mM TrisHCl, pH 8.0, 20% glycerol, 1 mM EDTA |
Pre-Refolding Purification | Metal affinity chromatography |
Tag Cleaved | no |
Refolding pH | 8.0 |
Refolding Temperature | 20.0 |
Protein Concentration | n/a |
Refolding Time | 16h |
Redox Agent | DTT |
Redox Agent Concentration | 1 mM |
Refolding Protocol | Inclusion bodies were solubilized, and underwent dialysis against refolding buffer. Refolded protein was the purified by affinity chromatography on Ni-NTA-agarose column. |
Refolding Assay | Ligand Binding,Western Blot |
Refolding Chaperones | None |
Refolding Additives | Glycerol |
Additives Concentration | 20% |
Refolding Yield | n/a |
Purity | n/a |
Notes | n/a |