Refolding Record:
Protein | |
---|---|
Protein Name | RNA-editing complex protein MP42 |
Abbreviated Name | TbMP42 |
SCOP Family | Unknown |
Structure Notes | |
Organism | Trypanosoma brucei |
UniProt Accession | Q95W13 |
SCOP Unique ID | n/a |
Structure Solved | |
Class | Unknown |
Molecularity | Monomer |
Construct | |
---|---|
Full Length | n |
Domain | n/a |
Chimera | n/a |
Variants | N-terminal Variant (aa 1-250) |
Chain Length | 161 |
Molecular Weight | 17019.3 |
Pi | 9.84 |
Molecular Weight | 17019.3 |
Disulphides | 0 |
Full Sequence |
MKRVTSHISRFLPLVLSQRGLSTYASPHVSSMRYYGATKCLLASTPDTPSFQCGECGKAF
RLINALNHHIMTKHAGKAKAMMNKGGKLEEVNPEEIKNKPQGAMSQPTSPPPSSSTSGTE
AASTSPTHSSFPGIPFSPVGGIGLVGTPVGGGSRSHHHHHH
|
Notes | n/a |
Expression | |
---|---|
Report | Brecht, M., Niemann, M., Schluter, E., Muller, U. F., Stuart, K., Goringer, H. U. (2005) Mol Cell, 17, 621-630 |
Project Aim | Functional Studies |
Fusion | C-terminal hexahistidine tag |
Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
Expression Host | Escherichia coli |
Expression Strain | M15pREP4 |
Expression Temp | 37.0 |
Expression Time | 3h |
Expression Vector | pQE60 |
Expression Protocol | Cells were grown in 1L culture, induced and incubated. Cells were then harvested, and lysed in lysis buffer (10mM TrisHCl, pH 8.0, 0.1M NaH2PO4, 8M urea). Lysates were loaded onto a Ni-chelating column and bound protein eluted using a pH step gradient (pH 6.3, pH 5.9, pH 3.0). Fractions containing rTbMP42 were then purified by anion exchange chromatography under denaturing conditions (8M Urea). |
Method of Induction | IPTG |
Cell Density at Induction | OD 600 = 0.5-0.6 |
Cell Disruption Method | Chemical |
Lytic Agent | Chemicals |
Pre-Refolding Purification | Metal affinity chromatography/ion exchange chromatography |
Solubility | insoluble |
Refolding | |
---|---|
Refolding Method | Dialysis |
Wash Buffer | n/a |
Solubilization Buffer | 8 M urea |
Refolding Buffer | 20 mM HEPES, pH 7.5, 30 mM KCL, 10 mM Mg(OAc)2, 5 mM CaCl2, 1 mM ZnSO4 |
Pre-Refolding Purification | Metal affinity chromatography/ion exchange chromatography |
Tag Cleaved | no |
Refolding pH | 7.5 |
Refolding Temperature | 4.0 |
Protein Concentration | n/a |
Refolding Time | n/a |
Redox Agent | None |
Redox Agent Concentration | n/a |
Refolding Protocol | Refolding was preformed, after purification steps, by dialysis against refolding buffer. |
Refolding Assay | Enzyme activity |
Refolding Chaperones | None |
Refolding Additives | None |
Additives Concentration | n/a |
Refolding Yield | 0.12mg/ml |
Purity | n/a |
Notes | n/a |