Refolding Record:
| Protein | |
|---|---|
| Protein Name | Lipase |
| Abbreviated Name | lip4 |
| SCOP Family | Fungal lipases |
| Structure Notes | |
| Organism | Clostridium thermocellum |
| UniProt Accession | P32948 |
| SCOP Unique ID | n/a |
| Structure Solved | |
| Class | Alpha/Beta |
| Molecularity | Monomer |
| Construct | |
|---|---|
| Full Length | y |
| Domain | n/a |
| Chimera | n/a |
| Variants | n/a |
| Chain Length | 558 |
| Molecular Weight | 58570.6 |
| Pi | 5.65209 |
| Molecular Weight | 58570.6 |
| Disulphides | 2 |
| Full Sequence |
MKLALVLSLIVSVAAAPTATLANGDTITGLNAIINEAFLGIPFAQPPVGNLRFKPPVPYS
ASLNGQKFTSYGPSCMQMNPLGNWDSSLPKAAINSLMQSKLFQAVLPNGEDCLTINVVRP
SGTKPGANLPVMVWIFGGGFEVGGSSLFPPAQMITASVLMGKPIIHVSMNYRVASWGFLA
GPDIKAEGSGNAGLHDQRLGLQWVADNIAGFGGDPSKVTIFGESAGSMSVMCQLLWNDGD
NTYNGKPLFRAAIMQSGAMVPSDPVDGPYGTQIYDQVVASAGCGSASDKLACLRSISNDK
LFQATSDTPGALAYPSLRLSFLPRPDGTFITDDMFKLVRDGKCANVPVIIGDQNDEGTVF
ALSSLNVTTDAQARQYFKESFIHASDAEIDTLMAAYPSDITQGSPFDTGIFNAITPQFKR
IAAVLGDLAFTLPRRYFLNHFQGGTKYSFLSKQLSGLPVIGTHHANDIVWQDFLVSHSSA
VYNNAFIAFANDLDPNKAGLLVNWPKYTSSSQSGNNLLQINALGLYTGKDNFRTAGYDAL
FTNPSSFFV
|
| Notes | n/a |
| Expression | |
|---|---|
| Report | Tang SJ, Sun KH, Sun GH, Chang TY, Lee GC. (2000) Protein Expression and Purification, 20, 308-313 |
| Project Aim | Undefined |
| Fusion | None |
| Protein Expression and Production | Protein recombinantly expressed as and refolded from inclusion bodies. |
| Expression Host | Escherichia coli |
| Expression Strain | BL21 |
| Expression Temp | 37.0 |
| Expression Time | unknown |
| Expression Vector | unknown |
| Expression Protocol | unknown |
| Method of Induction | Not Stated |
| Cell Density at Induction | OD = |
| Cell Disruption Method | Sonication |
| Lytic Agent | None |
| Pre-Refolding Purification | None |
| Solubility | soluble |
| Refolding | |
|---|---|
| Refolding Method | Dilution |
| Wash Buffer | unknown |
| Solubilization Buffer | unknown |
| Refolding Buffer | unknown |
| Pre-Refolding Purification | None |
| Tag Cleaved | yes |
| Refolding pH | 7.5 |
| Refolding Temperature | 25.0 |
| Protein Concentration | |
| Refolding Time | |
| Redox Agent | None |
| Redox Agent Concentration | n/a,n/a,n/a |
| Refolding Protocol | unknown |
| Refolding Assay | Unspecified |
| Refolding Chaperones | None |
| Refolding Additives | None |
| Additives Concentration | NULL |
| Refolding Yield | |
| Purity | |
| Notes | |