| Article | |
|---|---|
| Title | Cloning and expression of the polyhydroxyalkanote depolymerase gene from Pseudomonas putida, and characterization of the gene product. |
| Abstract | A polyhydroxyalkanote (PHA) depolymerase gene ( pha Z) was cloned by PCR from Pseudomonas putida and over-expressed in Escherichia coli as inclusion bodies. Nucleotide sequence analysis predicted an 852 bp open reading frame encoding a protein of 283 amino acids with a predicted molecular weight of 31283 Da. The deduced amino acid sequence had at least 80% homology to the PHA depolymerase from other Pseudomonas strains and consisted a conserved lipase box-like sequence (G-X-S(102)-X-G). The inclusion bodies were refolded and biochemically characterized. The depolymerase activity was optimal at 40 degrees C and pH 8. |
| PubMed ID | 15604801 |
| Author | Jiang Yaqin, Ye Jiang, Wu Haizhen, Zhang Huizhan |
| Journal | Biotechnology letters. 26(20) 1585-8 |
| Date | 2004 Oct |
| Protein | |
|---|---|
| Protein name | Polyhydroxyalkanote depolymerase |
| Amino acid sequence | MPQPYVFRTVELDDQSIRTAVRPGKPHLTPLLIFNGIGANLELVFPFIEALDPDLEVIAF DVPGVGGSSTPRQPYRFPGLAKLTARMLDYLDYGQVNVIGVSWGGALAQQFAHDYPERCK KLVLAATAAGAVMVPGKPKVLWMMASPRRYVQPSHVMRIAPLIYGGAFRRDPPLAARHAA KVRSGGKLGYYWQLFAGLGWTSIHWAAQDQPADSGLAGDDDPLIPLINMRLLAWRIPNAQ LHIIDDGHLFLIIRAEAVAPIIMKFLEQERQRARMHPRPASGT |
| Comment | Q6PLI2 |
| UniProt ID | Q6PLI2 |
| Function | |
| Domain | |
| Experiment | |||
|---|---|---|---|
| Refolding method | ☑ dilution | ☐ column:filtration | ☐ high pressure |
| ☐ dialysis | ☐ column:binding | ☐ other method | |
| pH | 8 | ||
| Temperature℃ | 25 | ||
| Validation | ☑ activity | ☐ solubility | ☐ non aggregability |
| ☐ circular dichroism | ☐ fluorescence tryptophan | ☐ nuclear magnetic resonance | |
| ☐ crystallization | ☐ structure determination | ||
| Link to Monash University REFOLD database | |
|---|---|
| Link | /refolddatabase/refoldingrecord/1171/ |